PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10028602m
Common NameCARUB_v10028602mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LFY
Protein Properties Length: 423aa    MW: 46624.3 Da    PI: 7.1121
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10028602mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY625.78e-19113911386
          FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmksls 94 
                      mdpe f++ lf+w+p  a++++p  + + + ++++p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++m+sls
  Carubv10028602m   1 MDPEGFTSGLFRWNPMRAMVQAPPPVPP-SPQQQQPVTPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEMMNSLS 93 
                      9*************77776665555544.44556666777888888899********************************************* PP

          FLO_LFY  95 eifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekks 181
                      +ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll      + +++aldalsqeglseepvq++ ++ ++g++g g ++   a ++k 
  Carubv10028602m  94 HIFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaagDSGTHHALDALSQEGLSEEPVQQQDQTDAAGNNGGGGSGYWEAGQAK- 186
                      **************************99544456778887778844344556****************9777666666665666666655322. PP

          FLO_LFY 182 eeekkkaskkkqkrkkkkelkseededeeeeededeeg.....sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkia 270
                         kk++ + +++ kk   ++ e+d+d +e ed+d+++     +g  g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLlqvq+ia
  Carubv10028602m 187 --MKKQQ-Q-RRR-KKPMVASVETDDDGNEGEDDDGMDngnggGGGMGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLLQVQTIA 275
                      ..22222.2.222.22222233334444443333333312222556677********************************************* PP

          FLO_LFY 271 kerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahpr 364
                      k+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde+asnalrr+fkergenvG+wrqacykplv+ia r+gwdidavfnahpr
  Carubv10028602m 276 KDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRSFKERGENVGSWRQACYKPLVNIACRHGWDIDAVFNAHPR 369
                      ********************************************************************************************** PP

          FLO_LFY 365 LsiWYvPtkLrqLChlerskas 386
                      LsiWYvPtkLrqLChler++a+
  Carubv10028602m 370 LSIWYVPTKLRQLCHLERNNAV 391
                      ******************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.1E-2001390IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPMRAMV QAPPPVPPSP QQQQPVTPQT AAFGMRLGGL EGLFGAYGIR  60
FYTAAKIAEL GFTASTLVGM KDEELEEMMN SLSHIFRWEL LVGERYGIKA AVRAERRRLQ  120
EEEEEESSRR RHLLLSAAGD SGTHHALDAL SQEGLSEEPV QQQDQTDAAG NNGGGGSGYW  180
EAGQAKMKKQ QQRRRKKPMV ASVETDDDGN EGEDDDGMDN GNGGGGGMGT ERQREHPFIV  240
TEPGEVARGK KNGLDYLFHL YEQCREFLLQ VQTIAKDRGE KCPTKVTNQV FRYAKKSGAS  300
YINKPKMRHY VHCYALHCLD EDASNALRRS FKERGENVGS WRQACYKPLV NIACRHGWDI  360
DAVFNAHPRL SIWYVPTKLR QLCHLERNNA VAAAAALVGG GISCTGSSTS GRGGCGGDEL  420
RF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1362284221194PROTEIN LEAFY
2vy2_A1e-1362284221194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4719320.0DQ471932.1 Brassica juncea cultivar Varuna LEAFY transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282313.10.0hypothetical protein CARUB_v10028602mg
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLR0F1N90.0R0F1N9_9BRAS; Uncharacterized protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)